PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088788.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 287aa    MW: 31388.9 Da    PI: 8.4453
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088788.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.82.2e-161150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i n+s r+ +f kR++g++KK +ELS+LC+++++ ii+s+
  XP_011088788.1 11 ITNDSERKASFKKRKKGLIKKVSELSTLCGVDACAIIYSQ 50
                    89************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.526150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.1E-23296IPR002100Transcription factor, MADS-box
CDDcd002667.68E-20285No hitNo description
PRINTSPR004041.4E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTRKKVTLAY ITNDSERKAS FKKRKKGLIK KVSELSTLCG VDACAIIYSQ YDQEPEVWPS  60
PLGAQAVLAR FRKLSEMDQT RKMVNQESFT RQRIKKAEDQ LRRVQKENKR KELENFMFQC  120
LAGMATLEDF NLRDAAEMGW VVNQTLREIN TRMETLQKTG QHQQPAVGEA SGSAPAGAAV  180
AVTVAVAPPP PPVQMVAPPP PPPLQMVAPL PPPPPPPTMN VDPPLPGEEN MESFPWNLVE  240
SPTGAGGAAL YGSGLAGWDD GVVLPYPYIF NHGNNSSSGT QPGQQIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLAYITNDSERKASFKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088788.10.0PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK32e-55AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A022RJB02e-74A0A022RJB0_ERYGU; Uncharacterized protein (Fragment)
STRINGPOPTR_0005s00420.17e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15322367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-54AGAMOUS-like 80